ООО «Лабораторная Диагностика»
ООО «Лабораторная Диагностика» info@LD.ru    тел.: +7 495 369-20-43
 Главная   Новости   О компании  Каталог продукции и цены   Оформить заказ   Контакты 
 
  
Каталог продукции
  Гематология и трансфузиология
  Гемостаз  
  Иммуногистохимия
  Иммуноферментный анализ (ИФА)
  Иммунохимия  
  Клеточные технологии
  Клиническая биохимия
  Коагулометрия  
  Микробиология  
  Молекулярная диагностика
  Мультиплексный анализ  
  Оборудование для биохимии и
  молекулярной биологии
  Общелабораторное оборудование
  Онкология  
  Пищевая промышленность  
  Программное обеспечение  
  Проточная цитометрия
  ПЦР-лаборатория
  Рекомбинантные белки
  Репродуктивные технологии
  Секвенирование NGS
  Сортировка клеток
  Спектрофотометрия  
  Трансплантология
  Цитогенетическая диагностика
  Экспресс-лаборатория  

 
/ Каталог / Протеомика / Белки / Белки производства Cusabio

Recombinant Human Ciliary neurotrophic factor(CNTF)

Purity Greater than 85% as determined by SDS-PAGE.
Target Names CNTF
Uniprot No. P26441
Research Area Neuroscience
Alternative Names Ciliary neurotrophic factor; CNTF; CNTF_HUMAN; HCNTF
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-200aa
Target Protein Sequence MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 27.0 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Информация для заказа

Область использования:Производство:Cusabio
Метод: 
Объем:100 мкг 
Кат. номер:CSB-EP005683HU-100
Цена (с НДС 20%):по запросуВ корзину
Наименование: Recombinant Human Ciliary neurotrophic factor(CNTF).
Примечание:
   
© ООО «Лабораторная Диагностика»
info@LD.ru   тел.: +7 495 369-20-43