| Description |
The recombinant Pseudomonas aeruginosa lecA protein is a fusion protein consists of the Pseudomonas aeruginosa
lecA protein (2-122aa) partnered with the N-terminal 6xHis tag. It was produced in the E.coli. This recombinant lecA protein's purity is greater than 90% determined by SDS-PAGE. After electrophoresis, there is a 16 kDa protein band presented on the gel.
LecA is a cytotoxic lectin and adhesin produced by Pseudomonas aeruginosa which binds hydrophobic galactosides with high specificity and affinity. Certain research showed that lecA is expressed in biofilm-grown cells. The carbohydrate-binding protein LecA from Pseudomonas aeruginosa plays an important role in the formation of biofilms in chronic infections. Development of inhibitors to disrupt LecA-mediated biofilms is desired but it is limited to carbohydrate-based ligands. Moreover, discovery of drug-like ligands for LecA is challenging because of its weak affinities. Lectins are carbohydrate-binding proteins with diverse functions that are found in all domains of life. Lectins are involved in the infection process of the Gram-negative bacterium Pseudomonas aeruginosa, an important member of the often highly drug-resistant ESKAPE pathogens. The two bacterial lectins LecA and LecB, are virulence factors that are important for bacterial adhesion. LecA and LecB, which can be specific for galactose and fucose (Fuc), respectively. The affinity of Fuc and LecB was much higher than that of galactose and LecA. Multiple saccharin and saccharide inhibitors targeting LecB have successfully applied to treat P.aeruginosa infection.
|
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Target Names |
lecA |
| Uniprot No. |
Q05097 |
| Research Area |
Others |
| Alternative Names |
lecA; pa1L; PA2570; PA-I galactophilic lectin; PA-IL; Galactose-binding lectin |
| Species |
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) |
| Source |
E.coli |
| Expression Region |
2-122aa |
| Target Protein Sequence |
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVA PNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight |
16.8kDa |
| Protein Length |
Full Length of Mature Protein |
| Tag Info |
N-terminal 6xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition |
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |