| Description |
This Human MUC17 (Mucin-17) recombinant protein was produced in mammalian cell, where the gene sequence encoding human MUC17 (4131-4390aa) was expressed with the C-terminal 10xHis tag. The purity of this MUC17 protein was greater than 95% by SDS-PAGE. The activity was tested. As a newly discovered mucin, MUC17 (Mucin-17) belongs to the membrane-bound mucin family. Mucins are highly O-glycosylated linear glycoproteins secreted by higher organisms to protect and lubricate epithelial cell surfaces and are involved in the regulation of immune responses, inflammation, adhesion, and tumorigenesis. M... Read more
|
| Purity |
Greater than 95% as determined by SDS-PAGE. |
| Endotoxin |
Less than 1.0 EU/ug as determined by LAL method. |
| Activity |
Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody (CSB-RA727848MA1HU), the EC50 is 0.9057-1.259 ng/mL. |
| Target Names |
MUC17 |
| Uniprot No. |
Q685J3 |
| Research Area |
other |
| Alternative Names |
(MUC-17)(Small intestinal mucin-3)(MUC-3) |
| Molecular Characterization |
 |
| Species |
Homo sapiens (Human) |
| Source |
Mammalian cell |
| Expression Region |
4131-4390aa |
| Target Protein Sequence |
RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQT FTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQN ITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL |
| Mol. Weight |
32.0kDa |
| Protein Length |
Partial |
| Tag Info |
C-terminal 10xHis-tagged |
| Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer |
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition |
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |