Recombinant Human Stromal cell-derived factor 1 protein(CXCL12)
Recombinant Human Stromal cell-derived factor 1 protein(CXCL12) (Active) - Cusabio
| Alternative Names |
12-O-tetradecanoylphorbol 13-acetate repressed protein 1; AI174028; C-X-C motif chemokine 12; Chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1); Chemokine (C-X-C motif) ligand 12; Chemokine CXC motif ligand 12; cxcl12; hIRH; hSDF-1; Intercrine reduced in hepatomas; IRH; OTTHUMP00000019491 ; PBSF; Pre-B cell growth-stimulating factor; SCYB12; SDF 1; SDF-1; SDF-1-alpha(3-67); SDF-1a; SDF-1b; SDF1_HUMAN; SDF1A; SDF1B; Stromal cell-derived factor 1; Stromal cell-derived factor 1 delta ; Stromal cell-derived factor 1 gamma ; Stromal cell-derived factor 1a ; Stromal cell-derived factor-1 alpha ; Thymic lymphoma cell-stimulating factor; Tlsf; TLSF-a; TLSF-b; Tlsfa; Tlsfb; TPAR1 |
| Species |
Homo sapiens (Human) |
| Source |
E.coli |
| Expression Region |
22-93aa |
| Complete Sequence |
KPVSLSYRCP CRFFESHVAR ANVKHLKILN TPNCALQIVA RLKNNNRQVC IDPKLKWIQE YLEKALNKRF KM |
| Mol. Weight |
8.5 kDa |
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | Рекомбинантные белки |
| Объем: | 10 мкг |
| Кат. номер: | CSB-AP000751HU-10 |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant Human Stromal cell-derived factor 1 protein(CXCL12). Примечание: Expression Region: 22-93aa; Full Length of Mature ProteinTag information: Tag-FreeTarget Protein Sequence:KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKMBiological activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/ml. |