| Объем | 50 мкг | 
| Категория | Drug Target | 
| Подраздел | Immune Checkpoint | 
| Области исследований | Cancer | 
| Uniprot NO# | P47741 | 
| Наименование гена | Tnfrsf4 | 
| Специфичность | Mus musculus (Mouse) | 
| Источник | Mammalian cell | 
| Регион экспрессии | 20-211aa | 
| Последовательность | VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP | 
| Описание белка | Extracellular Domain | 
| Информация о TAG  | C-terminal 6xHis-tagged | 
| Мол. вес | 22.1 kDa | 
| Примечание | специальная цена до 30.06.2019! | 
| Биологическая активность | The ED50 as determined by its ability to bind Mouse TNFSF4 in functional ELISA is less than 50 ug/ml. | 
| Очистка | Greater than 95% as determined by SDS-PAGE. | 
| Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. | 
| Буфер хранения | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 | 
| Альтернативное имя / Синоним | Tumor necrosis factor receptor superfamily member 4;Tnfrsf4;OX40;CD134;Txgp1 | 
| Актуальность | OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs). The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases. | 
| Функция | Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).  | 
| Субклеточное расположение | Membrane, Single-pass type I membrane protein | 
| UniGene Database Link | ссылка | 
| KEGG Database Link | ссылка | 
| STRING Database Link | ссылка | 
| Ссылка на страницу на сайте производителя | ссылка | 
|   |   |