ООО «Лабораторная Диагностика»
ООО «Лабораторная Диагностика» info@LD.ru    тел.: +7 495 369-20-43
 Главная   Новости   О компании  Каталог продукции и цены   Оформить заказ   Контакты 
 
  
Каталог продукции
  Гематология  
  Гемостаз  
  Иммуногематология  
  Иммуногистохимия
  Иммуноферментный анализ (ИФА)
  Иммунохимия  
  Клеточные технологии  
  Клиническая биохимия
  Коагулометрия  
  Микробиология  
  Мультиплексный анализ  
  Оборудование для биохимии и
  молекулярной биологии
  Общелабораторное оборудование
  Онкология  
  Пищевая промышленность  
  Программное обеспечение  
  Проточная цитометрия
  ПЦР-лаборатория
  Рекомбинантные белки
  Репродуктивные технологии
  Сортировка клеток
  Спектрофотометрия  
  Стволовые клетки (Stem Cells)
  Трансплантология
  Цитогенетическая диагностика
  Экспресс-лаборатория  

 
/ Каталог / Протеомика / Белки / Белки-мишени лекарственных средств CUSABIO (Drug Target Protein CUSABIO)

Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),partial

Спецификация

Объем10 мкг
КатегорияDrug Target
ПодразделImmune Checkpoint
Области исследованийImmunology
Uniprot NO#P09793
Наименование генаCtla4
СпецифичностьMus musculus (Mouse)
ИсточникMammalian cell
Регион экспрессии37-161aa
ПоследовательностьAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Описание белкаPartial
Информация о TAG C-terminal 6xHis-tagged
Мол. вес14.6 kDa
Примечаниеспециальная цена до 30.06.2019!
Биологическая активностьThe ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/ml.
ОчисткаGreater than 95% as determined by SDS-PAGE.
ЭндотоксинLess than 1.0 EU/µg as determined by LAL method.
Буфер храненияLyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Альтернативное имя / СинонимCytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD152; Ctla4
АктуальностьMouse Cytotoxic Tlymphocyte 4(CTLA-4,CD152), is a type I transmembrane T cell inhibitory molecule. mouse CTLA4 cDNA encodes 223 amino acids (aa) including a 35 aa signal sequence, a 126 aa extracellular domain (ECD) with one Ig-like V-type domain, a 21 aa transmembrane (TM) sequence, and a 41 aa cytoplasmic sequence. Within the ECD, Mouse CTLA-4 shares 68% aa sequence identity with human. CTLA4 is similar to the T cell costimulatory protein CD28 since both of the molecules bind to CD80 and CD86 on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found inregulatory T cells and may play an important role in their functions. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA4. Genetic variations of CTLA4 have been associated with susceptibility to systemic lupus erythematosus(SLE), Gravesdisease(GRD), Celiac disease type3(CELIAC3) and Hepatitis B virus infection(HBVinfection).
ФункцияInhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Субклеточное расположениеCell membrane, Single-pass type I membrane protein
Тканевая специфичностьWidely expressed with highest levels in lymphoid tissues.
UniGene Database Linkссылка
KEGG Database Linkссылка
STRING Database Linkссылка
Ссылка на страницу на сайте производителяссылка
  

Информация для заказа

Область использования:Производство:Cusabio
Метод: 
Объем:10 мкг 
Кат. номер:CSB-AP005301MO
Цена (с НДС 20%):по запросуВ корзину
Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),partialНаименование: Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),partial.
Примечание: дополнительная информация (на английском языке).
   
© ООО «Лабораторная Диагностика»
info@LD.ru   тел.: +7 495 369-20-43