| Объем | 10 мкг | 
| Категория | Drug Target | 
| Подраздел | Immune Checkpoint | 
| Области исследований | Cancer | 
| Uniprot NO# | Q07011 | 
| Наименование гена | TNFRSF9 | 
| Специфичность | Homo sapiens (Human) | 
| Источник | Mammalian cell | 
| Регион экспрессии | 24-186aa | 
| Последовательность | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ | 
| Описание белка | Extracellular Domain | 
| Информация о TAG  | C-terminal 6xHis-tagged | 
| Мол. вес | 18.1 kDa | 
| Примечание | специальная цена до 30.06.2019! | 
| Биологическая активность | The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml. | 
| Очистка | Greater than 95% as determined by SDS-PAGE. | 
| Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. | 
| Буфер хранения | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 | 
| Альтернативное имя / Синоним | CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA | 
| Актуальность | Tumor necrosis factor receptor superfamily member 9(TNFRSF9), also known as CD137 and 4-1BB, is an inducible T cell surface protein belonging to the tumor necrosis factor receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. CD137 is expressed by mesenchymal cells, including endothelial cells, chondrocytes, and cells of the central nervous system. CD137 is also broadly expressed by cells of the human immune system, is broadly expressed by cells of the human immune system, including activated CD8+ and CD4+ T cells, activated natural killer (NK) cells, follicular dendritic cells (FDCs) and monocytes. CD137 has diverse roles in the immune response, the one key function is to promote the survival of both T cells and dendritic cells by binding the cognate ligand CD137L (4-1BBL).  | 
| Функция | Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation. | 
| Субклеточное расположение | Membrane, Single-pass type I membrane protein | 
| Тканевая специфичность | Expressed on the surface of activated T-cells. | 
| HGNC Database Link | ссылка | 
| UniGene Database Link | ссылка | 
| KEGG Database Link | ссылка | 
| STRING Database Link | ссылка | 
| OMIM Database Link | ссылка | 
| Ссылка на страницу на сайте производителя | ссылка | 
|   |   |