ООО «Лабораторная Диагностика»
ООО «Лабораторная Диагностика» info@LD.ru    тел.: +7 495 369-20-43
 Главная   Новости   О компании  Каталог продукции и цены   Оформить заказ   Контакты 
 
  
Каталог продукции
  Рекомбинантные белки
  Cusabio
  OriGene
  Panomics
  ProSpec
  · Гормоны
  Евроген
  Гематология  
  Гемостаз  
  Иммуногематология  
  Иммуногистохимия
  Иммуноферментный анализ (ИФА)
  Иммунохимия  
  Клеточные технологии  
  Клиническая биохимия
  Коагулометрия  
  Микробиология  
  Мультиплексный анализ  
  Оборудование для биохимии и
  молекулярной биологии
  Общелабораторное оборудование
  Онкология  
  Пищевая промышленность  
  Программное обеспечение  
  Проточная цитометрия
  ПЦР-лаборатория
  Репродуктивные технологии
  Сортировка клеток
  Спектрофотометрия  
  Стволовые клетки (Stem Cells)
  Трансплантология
  Цитогенетическая диагностика
  Экспресс-лаборатория  

 
/ Каталог / Протеомика / Белки / Рекомбинантные белки

Recombinant Human Macrophage colony-stimulating factor 1 protein(CSF1) (Active)

Express Region33-190aa      ;Isoform 3 partial.
Tag informationUntagged
Express Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Информация для заказа

Область использования:Производство:Cusabio
Метод: 
Объем:100 мкг 
Кат. номер:CSB-AP002131HU-100
Цена (с НДС 20%):по запросуВ корзину
Наименование: Recombinant Human Macrophage colony-stimulating factor 1 protein(CSF1) (Active).
Примечание: дополнительная информация (на английском языке).
   
© ООО «Лабораторная Диагностика»
info@LD.ru   тел.: +7 495 369-20-43