| Product Type: |
Recombinant Protein |
| |
Code: |
CSB-YP006043HU >> Yeast
CSB-EP006043HU >> E.coli
CSB-BP006043HU >> Baculovirus
CSB-MP006043HU >> Mammalian cell |
| |
Size: |
1mg |
| |
Protein Names: |
Recommended name: Macrophage colony-stimulating factor 1 Short name= CSF-1 Short name= M-CSF Short name= MCSFAlternative name(s): LanimostimCleaved into the following chain: 1. Processed macrophage colony-stimulating factor 1 |
| |
Gene Names: |
Name:CSF1 |
| |
Species: |
Homo sapiens (Human) |
| |
Product Info: |
His tagged |
| |
Purity: |
>90% |
| |
Storage Buffer: |
Tris-based buffer,50% glycerol |
| |
Storage: |
Store at -20℃, for extended storage, conserve at -20℃ or -80℃. |
| |
Notes: |
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| |
Protocol: |
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
|
| |
AA sequence: |
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDI MEDTMRFRDNTPNAIAIVQLQELSL...... |
| |
Expression Region: |
33-554 |
