Recombinant Rat Thrombopoietin protein
Relevance: Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Product Info:
Source:
Purity: 90%
Image:

Tested applications: ELISA, Western blot
Storage Buffer: PBS (PH:8.0),1?M Leupeptin,1?M pepstatin,100?M EDTA
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKFPNRTSGLLETNFSVVARTAGPGLLNRLQGFRAKIIPGQLNQTSGSLDQIPGYLNGTHEPVNGTHGLFAGTSLQTLEAPDVVPGAFNKGSLPLNLQSGLPPIPSLAADGYTLFPPSPTFPTPGSPPQLPPVS
Referrences: "The sequence of a rat cDNA encoding thrombopoietin." Ogami K., Shimada Y., Sohma Y., Akahori H., Kato T., Kawamura K., Miyazaki H. Gene 158:309-310(1995) [PubMed: 7607561] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Liver. Mol. Endocrinol. 3:1681-1692(1989) [2]"Complete nucleotide sequence of the cDNA for thyroid peroxidase in FRTL5 rat thyroid cells." Derwahl M., Seto P., Rapoport B. Nucleic Acids Res. 17:8380-8380(1989)
Alias: .
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 50 мкг |
| Кат. номер: | CSB-RP076444r |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant Rat Thrombopoietin protein. Примечание: дополнительная информация (на английском языке). |