Recombinant mouse C-C motif chemokine 3 protein
Relevance: Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Referrences: [1] "Cloning and characterization of a cDNA for murine macrophage inflammatory protein (MIP), a novel monokine with inflammatory and chemokinetic properties." Davatelis G., Tekamp-Olson P., Wolpe S.D., Hermsen K., Luedke C., Gallegos C., Coit D., Merryweather J., Cerami A. J. Exp. Med. 167:1939-1944(1988) [PubMed: 3290382] [Abstract] Cited for: NUCLEOTIDE SEQUENCE. [2] Erratum Davatelis G., Tekamp-Olson P., Wolpe S.D., Hermsen K., Luedke C., Gallegos C., Coit D., Merryweather J., Cerami A. J. Exp. Med. 170:2189-2189(1989) Cited for: SEQUENCE REVISION. [3] "A family of small inducible proteins secreted by leukocytes are members of a new superfamily that includes leukocyte and fibroblast-derived inflammatory agents, growth factors, and indicators of various activation processes." Brown K.D., Zurawski S.M., Mosmann T.R., Zurawski G. J. Immunol. 142:679-687(1989) [PubMed: 2521353] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [4] "Sequence of the murine haemopoietic stem cell inhibitor/macrophage inflammatory protein 1 alpha gene." Grove M., Lowe S., Graham G., Pragnell I., Plumb M. Nucleic Acids Res. 18:5561-5561(1990) [PubMed: 2216738] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: DBA/2J. [5] "cDNA sequences of two inducible T-cell genes." Kwon B.S., Weissman S.M. Proc. Natl. Acad. Sci. U.S.A. 86:1963-1967(1989) [PubMed: 2784565] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: Heparin-binding chemotaxis protein,L2G25B,Macrophage inflammatory protein 1-alpha,MIP-1-alpha,SIS-alpha Small-inducible cytokine A3,TY-5.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 1 мг |
| Кат. номер: | CSB-RP090574m |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant mouse C-C motif chemokine 3 protein. Примечание: дополнительная информация (на английском языке). |