Recombinant mouse C-C motif chemokine 2 protein
Relevance: Chemotactic factor that attracts monocytes, but not neutrophils.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Referrences: [1] "Platelet-derived growth factor-inducible gene JE is a member of a family of small inducible genes related to platelet factor 4." Kawahara R.S., Deuel T.F. J. Biol. Chem. 264:679-682(1989) [PubMed: 2910858] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "Cloning and expression of JE, a gene inducible by platelet-derived growth factor and whose product has cytokine-like properties." Rollins B.J., Morrison E.D., Stiles C.D. Proc. Natl. Acad. Sci. U.S.A. 85:3738-3742(1988) [PubMed: 3287374] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Sequence polymorphisms in the chemokines Scya1 (TCA-3), Scya2 (monocyte chemoattractant protein (MCP)-1), and Scya12 (MCP-5) are candidates for eae7, a locus controlling susceptibility to monophasic remitting/nonrelapsing experimental allergic encephalomyelitis." Teuscher C., Butterfield R.J., Ma R.Z., Zachary J.F., Doerge R.W., Blankenhorn E.P. J. Immunol. 163:2262-2266(1999) [PubMed: 10438970] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANTS GLY-50 AND GLN-92. Strain: B10.S/J, BALB/c, DBA/2J, NOD/LtJ and SJL/J. Tissue: Spleen. [4] "Production and identification of natural monocyte chemotactic protein from virally infected murine fibroblasts. Relationship with the product of the mouse competence (JE) gene." van Damme J., Decock B., Bertini R., Conings R., Lenaerts J.-P., Put W., Opdenakker G., Mantovani A. Eur. J. Biochem. 199:223-229(1991) [PubMed: 2065676] [Abstract] Cited for: PROTEIN SEQUENCE OF 26-42.
Alias: Monocyte chemoattractant protein 1,Monocyte chemotactic protein 1,MCP-1,Platelet-derived growth factor-inducible protein JE,Small-inducible cytokine A2.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 200 мкг |
| Кат. номер: | CSB-RP090474m |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant mouse C-C motif chemokine 2 protein. Примечание: дополнительная информация (на английском языке). |