Recombinant humanTumor necrosis factor receptor superfamily member 6 protein
Relevance: Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
Product Info: GST tagged
Source: E.coli derived
Purity: 95%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSR
Referrences: [1] "The polypeptide encoded by the cDNA for human cell surface antigen Fas can mediate apoptosis." Itoh N., Yonehara S., Ishii A., Yonehara M., Mizushima S., Sameshima M., Hase A., Seto Y., Nagata S. Cell 66:233-243(1991) [2] "Purification and molecular cloning of the APO-1 cell surface antigen, a member of the tumor necrosis factor/nerve growth factor receptor superfamily. Sequence identity with the Fas antigen." Oehm A., Behrmann I., Falk W., Pawlita M., Maier G., Klas C., Li-Weber M., Richards S., Dhein J., Trauth B.C., Ponstingl H., Krammer P.H.J. Biol. Chem. 267:10709-10715(1992) [3] "Differential expression of human Fas mRNA species upon peripheral blood mononuclear cell activation."Liu C., Cheng J., Mountz J.D.Biochem. J. 310:957-963(1995)
Alias: .
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 1 мг |
| Кат. номер: | CSB-RP063544h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant humanTumor necrosis factor receptor superfamily member 6 protein. Примечание: дополнительная информация (на английском языке). |