Recombinant human Tricarboxylate transport protein, mitochondrial protein
Relevance: Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL
Referrences: [1] "Localization of the human mitochondrial citrate transporter protein gene to chromosome 22q11 in the DiGeorge syndrome critical region." Heisterkamp N., Mulder M.P., Langeveld A., ten Hoeve J., Wang Z., Roe B., Groffen J. Genomics 29:451-456(1995) [PubMed: 8666394] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Cloning, genomic organization, and chromosomal localization of human citrate transport protein to the DiGeorge/velocardiofacial syndrome minimal critical region." Goldmuntz E., Wang Z., Roe B.A., Budarf M.L. Genomics 33:271-276(1996) [PubMed: 8660975] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. Tissue: Brain.
Alias: Citrate transport protein,CTP,Solute carrier family 25 member 1,Tricarboxylate carrier protein.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 50 мкг |
| Кат. номер: | CSB-RP049544h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Tricarboxylate transport protein, mitochondrial protein. Примечание: дополнительная информация (на английском языке). |