Recombinant human Transcription factor BTF3 protein
Relevance: General transcription factor. BTF3 can form a stable complex with RNA polymerase II. Required for the initiation of transcription.
Product Info: GST-tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: TIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
Referrences: [1] "Sequencing and expression of complementary DNA for the general transcription factor BTF3." Zheng X.M., Black D., Chambon P., Egly J.-M. Nature 344:556-559(1990) [PubMed: 2320128] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). [2] "Genomic structure of the putative BTF3 transcription factor." Kanno M., Chalut C., Egly J.-M. Gene 117:219-228(1992) [PubMed: 1386332] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Leukocyte. [3] "cDNA expression and human 2D-gel data bases: towards integrating protein and DNA information." Leffers H., Honore B., Madsen A., Nielsen M.S., Anderson A.H., Celis J.E. Submitted (JUL-1993) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Alias: RNA polymerase B transcription factor 3.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 1 мг |
| Кат. номер: | CSB-RP017144h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Transcription factor BTF3 protein. Примечание: дополнительная информация (на английском языке). |