Recombinant human Teratocarcinoma-derived growth factor 1 protein
Relevance: Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MDCRKMARSYSVIWIMAISKVGVAGGHARSRGYARDDSIWAIRRSSRVMGIHSKNRTCCNGGTCMGSCACSYGRNCHDVRKNCGSVHDTWKKCSCKCWHGRCAGCDGVMDHVASRTSARTTTMVGICSISYY
Referrences: [1] "Molecular characterization of a gene of the 'EGF family' expressed in undifferentiated human NTERA2 teratocarcinoma cells." Ciccodicola A., Dono R., Obici S., Zollo M., Persico M.G. EMBO J. 8:1987-1991(1989) [PubMed: 2792079] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Isolation and characterization of the CRIPTO autosomal gene and its X-linked related sequence." Dono R., Montuori N., Rocchi M., de Ponti-Zilli L., Ciccodicola A., Persico M.G. Am. J. Hum. Genet. 49:555-565(1991) [PubMed: 1882841] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A. Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Alias: Cripto-1 growth factor,CRGF,Epidermal growth factor-like cripto protein CR1.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 500 мкг |
| Кат. номер: | CSB-RP107674h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Teratocarcinoma-derived growth factor 1 protein. Примечание: дополнительная информация (на английском языке). |