Recombinant human Rhombotin-1 protein
Relevance: May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. Ref.3
Product Info: GST tagged
Source: E. coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
Referrences: [1] "The t(11;14)(p15;q11) in a T-cell acute lymphoblastic leukemia cell line activates multiple transcripts, including Ttg-1, a gene encoding a potential zinc finger protein." McGuire E.A., Hockett R.D., Pollock K.M., Bartholdi M.F., O'Brien S.J., Korsmeyer S.J. Mol. Cell. Biol. 9:2124-2132(1989) [PubMed: 2501659] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "An unusual structure of a putative T cell oncogene which allows production of similar proteins from distinct mRNAs." Boehm T., Greenberg J.M., Buluwela L., Lavenir I., Forster A., Rabbitts T.H. EMBO J. 9:857-868(1990) [PubMed: 2311586] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "T-cell translocation gene 1 (Ttg-1) encodes a nuclear protein normally expressed in neural lineage cells." McGuire E.A., Davis A.R., Korsmeyer S.J. Blood 77:599-606(1991) [PubMed: 1703797] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION. [4] "Comparative architectural aspects of regions of conserved synteny on human chromosome 11p15.3 and mouse chromosome 7 (including genes WEE1 and LMO1)." Cichutek A., Brueckmann T., Seipel B., Hauser H., Schlaubitz S., Prawitt D., Hankeln T., Schmidt E.R., Winterpacht A., Zabel B.U. Cytogenet. Cell Genet. 93:277-283(2001) [PubMed: 11528126] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Blood. [5] "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y. Nature 440:497-500(2006) [PubMed: 16554811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Alias: Cysteine-rich protein TTG-1,LIM domain only protein 1,LMO-1,T-cell translocation protein 1.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 50 мкг |
| Кат. номер: | CSB-RP020554h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Rhombotin-1 protein. Примечание: дополнительная информация (на английском языке). |