Recombinant human Platelet basic protein
Relevance: LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Referrences: [1] "Cloning of cDNA coding for connective tissue activating peptide III from a human platelet-derived lambda gt11 expression library." Wenger R.H., Wicki A.N., Walz A., Kieffer N., Clemetson K.J. Blood 73:1498-1503(1989) [PubMed: 2713489] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Platelet. [2] "Characterization of the human beta-thromboglobulin gene. Comparison with the gene for platelet factor 4." Majumdar S., Gonder D., Koutsis B., Poncz M. J. Biol. Chem. 266:5785-5789(1991) [PubMed: 1826003] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Localization of distal regulatory domains in the megakaryocyte-specific platelet basic protein/platelet factor 4 gene locus." Zhang C., Thornton M.A., Kowalska M.A., Sachis B.S., Feldman M., Poncz M., McKenzie S.E., Reilly M.P. Blood 98:610-617(2001) [PubMed: 11468158] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: C-X-C motif chemokine 7 Leukocyte-derived growth factor Short name=LDGF Macrophage-derived growth factor Short name=MDGF Small-inducible cytokine B7.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 50 мкг |
| Кат. номер: | CSB-RP090144h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Platelet basic protein. Примечание: дополнительная информация (на английском языке). |