Recombinant human Interleukin-8 protein E.coli
Relevance: May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP
Referrences: [1] "Transformation by Rous sarcoma virus induces a novel gene with homology to a mitogenic platelet protein." Sugano S., Stoeckle M.Y., Hanafusa H. Cell 49:321-328(1987) [PubMed: 3032449] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Constitutive expression of a gene encoding a polypeptide homologous to biologically active human platelet protein in Rous sarcoma virus-transformed fibroblasts." Bedard P.-A., Alcorta D., Simmons D., Luk K.-C., Erikson R.L. Proc. Natl. Acad. Sci. U.S.A. 84:6715-6719(1987) [PubMed: 2821543] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "The chicken 9E3/CEF4 CXC chemokine is the avian orthologue of IL8 and maps to chicken chromosome 4 syntenic with genes flanking the mammalian chemokine cluster." Kaiser P., Hughes S., Bumstead N. Immunogenetics 49:673-684(1999) [PubMed: 10369926] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: Interleukin-8,IL-8,9E3,C-X-C motif chemokine 8,CEF-4, Embryo fibroblast protein 1,EMF-1.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 1 мг |
| Кат. номер: | CSB-RP157874h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Interleukin-8 protein E.coli. Примечание: дополнительная информация (на английском языке). |