Recombinant human Interleukin-1 alpha protein
Relevance: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Product Info: HIS-tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Referrences: [1] "Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs." March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D. Nature 315:641-647(1985) [PubMed: 2989698] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Complete nucleotide sequence of the gene for human interleukin 1 alpha." Furutani Y., Notake M., Fukui T., Ohue M., Nomura H., Yamada M., Nakamura S. Nucleic Acids Res. 14:3167-3179(1986) [PubMed: 3486405] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Cloning and characterization of the cDNAs for human and rabbit interleukin-1 precursor." Furutani Y., Notake M., Yamayoshi M., Yamagishi J., Nomura H., Ohue M., Furuta R., Fukui T., Yamada M., Nakamura S. Nucleic Acids Res. 13:5869-5882(1985) [PubMed: 2994016] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT SER-114. [4] "Cloning of the cDNA coding for human prointerleukin-1 alpha and prointerleukin-1 beta." Kotenko S.V., Bulenkov M.T., Veiko V.P., Epishin S.M., Lomakin I.B., Emel'Yanov A.V., Kozlov A.P., Konusova V.G., Kotov A.Y., Kurbatova T.V., Reshetnikov V.L., Simbirtsev A.S., Ketlinskii S.A., Vinetskii Y.P. Dokl. Akad. Nauk SSSR 309:1005-1008(1989) [PubMed: 2635664] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT SER-114. [5] "Recombinant human interleukin 1 alpha: purification and biological characterization." Gubler U., Chua A.O., Stern A.S., Hellmann C.P., Vitek M.P., Dechiara T.M., Benjamin W.R., Collier K.J., Dukovich M., Familletti P.C., Fiedler-Nagy C., Jenson J., Kaffka K., Kilian P.L., Stremlo D., Wittreich B.H., Woehle D., Mizel S.B., Lomedico P.T. J. Immunol. 136:2492-2497(1986) [PubMed: 3485152] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: Hematopoietin-1.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 200 мкг |
| Кат. номер: | CSB-RP065674h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Interleukin-1 alpha protein. Примечание: дополнительная информация (на английском языке). |