Recombinant human Fibroblast growth factor 21 protein
Relevance: FGF21 is a growth factor that is a member of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF21, in the presence of betaKlotho as a protein cofactor, signals through the FGFR 1c and 4 receptors and stimulates insulin independent glucose uptake by adipocytes.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: ELISA, Western blot
Storage Buffer: 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin, PH 8.0; 200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Referrences: [1]"Identification of a novel FGF, FGF-21, preferentially expressed in the liver." Nishimura T., Nakatake Y., Konishi M., Itoh N. Biochim. Biophys. Acta 1492:203-206(2000) [2]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M. Genome Res. 13:2265-2270(2003)
Alias: FGF-21.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 500 мкг |
| Кат. номер: | CSB-RP064074h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Fibroblast growth factor 21 protein. Примечание: дополнительная информация (на английском языке). |