Recombinant human Cytochrome b-c1 complex subunit 8 protein
Relevance: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride,20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY
Referrences: [1] "Molecular cloning of a human homologue of bovine low molecular mass ubiquinone-binding protein gene." Fujiwara T., Kawai A., Shimizu F., Shinomiya K., Hirano H., Okuno S., Ozaki K., Katagiri T., Takeda S., Kuga Y., Shimada Y., Nagata M., Takaichi A., Watanabe T., Horie M., Nakamura Y., Takahashi E., Hirai Y. Submitted (NOV-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Brain. [2] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Pituitary and Skin. [3] "Ubiquinol-cytochrome-c reductase from human and bovine mitochondria." Schaegger H., Brandt U., Gencic S., von Jagow G. Methods Enzymol. 260:82-96(1995) [PubMed: 8592474] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-16. Tissue: Heart and Liver.
Alias: Complex III subunit 8,Complex III subunit VIII,Ubiquinol-cytochrome c reductase complex 9.5 kDa protein,Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 500 мкг |
| Кат. номер: | CSB-RP038554h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Cytochrome b-c1 complex subunit 8 protein. Примечание: дополнительная информация (на английском языке). |