Recombinant human Cathepsin F protein
Relevance: Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.
Product Info: His tagged
Source: E.coli derived
Purity: 95%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD
Referrences: [1] "Molecular cloning and structural and functional characterization of human cathepsin F, a new cysteine proteinase of the papain family with a long propeptide domain." Santamaria I., Velasco G., Pendas A.M., Paz A., Lopez-Otin C. J. Biol. Chem. 274:13800-13809(1999) [PubMed: 10318784] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Prostate. [2] "Full-length cDNA of human cathepsin F predicts the presence of a cystatin domain at the N-terminus of the cysteine protease zymogen." Naegler D.K., Sulea T., Menard R. Biochem. Biophys. Res. Commun. 257:313-318(1999) [PubMed: 10198209] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Ovary. [3] "The human cathepsin F gene -- a fusion product between an ancestral cathepsin and cystatin gene." Wex T., Wex H., Broemme D. Biol. Chem. 380:1439-1442(1999) [PubMed: 10661872] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: .
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 10 мкг |
| Кат. номер: | CSB-RP152794h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Cathepsin F protein. Примечание: дополнительная информация (на английском языке). |