Recombinant Human Carbonyl reductase [NADPH] 1 protein
Relevance: NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Referrences: [1] "Human carbonyl reductase. Nucleotide sequence analysis of a cDNA and amino acid sequence of the encoded protein." Wermuth B., Bohren K.M., Heinemann G., von Wartburg J.-P., Gabbay K.H. J. Biol. Chem. 263:16185-16188(1988) [PubMed: 3141401] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE. Tissue: Placenta. [2] "Induction of a human carbonyl reductase gene located on chromosome 21." Forrest G.L., Akman S., Krutzik S., Paxton R.J., Sparkes R.S., Doroshow J., Felsted R.L., Mohandas T., Bachur N.R. Biochim. Biophys. Acta 1048:149-155(1990) [PubMed: 2182121] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE. Tissue: Mammary gland. [3] "Genomic sequence and expression of a cloned human carbonyl reductase gene with daunorubicin reductase activity." Forrest G.L., Akman S., Doroshow J., Rivera H., Kaplan W.D. Mol. Pharmacol. 40:502-507(1991) [PubMed: 1921984] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: 15-hydroxyprostaglandin dehydrogenase [NADP+] NADPH-dependent carbonyl reductase 1 Prostaglandin 9-ketoreductase Prostaglandin-E(2) 9-reductase.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 500 мкг |
| Кат. номер: | CSB-RP141144h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant Human Carbonyl reductase [NADPH] 1 protein. Примечание: дополнительная информация (на английском языке). |