Recombinant human Calreticulin protein
Relevance: Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: ELISA, Western blot
Storage Buffer: 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin, PH 8.0; 200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: TVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
Referrences: [1]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [2]"Identification of a novel calreticulin isoform (Crt2) in human and mouse." Persson S., Rosenquist M., Sommarin M. Gene 297:151-158(2002)
Alias: CRP55,Calregulin,Endoplasmic reticulum resident protein 60,ERp60,HACBP,grp60.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 10 мкг |
| Кат. номер: | CSB-RP078674h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Calreticulin protein. Примечание: дополнительная информация (на английском языке). |