Recombinant human Alpha-synuclein protein
Relevance: May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
Referrences: 1] "Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease." Ueda K., Fukushima H., Masliah E., Xia Y., Iwai A., Yoshimoto M., Otero D.A., Kondo J., Ihara Y., Saitoh T. Proc. Natl. Acad. Sci. U.S.A. 90:11282-11286(1993) [PubMed: 8248242] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 61-95. Tissue: Brain. [2] "The NACP/synuclein gene: chromosomal assignment and screening for alterations in Alzheimer disease." Campion D., Martin C., Heilig R., Charbonnier F., Moreau V., Flaman J.-M., Petit J.-L., Hannequin D., Brice A., Frebourg T. Genomics 26:254-257(1995) [PubMed: 7601450] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2-4 AND 2-5). [3] "Tissue-dependent alternative splicing of mRNA for NACP, the precursor of non-A beta component of Alzheimer's disease amyloid." Ueda K., Saitoh T., Mori H. Biochem. Biophys. Res. Commun. 205:1366-1372(1994) [PubMed: 7802671] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2-4). Tissue: Brain.
Alias: Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 10 мкг |
| Кат. номер: | CSB-RP069944h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Alpha-synuclein protein. Примечание: дополнительная информация (на английском языке). |