Recombinant human Alpha-endosulfine protein
Relevance: Protein phosphatase inhibitor that specifically inhibits protein phosphatase 2A (PP2A) during mitosis. When phosphorylated at Ser-67 during mitosis, specifically interacts with PPP2R2D (PR55-delta) and inhibits its activity, leading to inactivation of PP2A, an essential condition to keep cyclin-B1-CDK1 activity high during M phase By similarity. Also acts as a stimulator of insulin secretion by interacting with sulfonylurea receptor (ABCC8), thereby preventing sulfonylurea from binding to its receptor and reducing K(ATP) channel currents. Ref.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
Referrences: [1] "Human alpha-endosulfine, a possible regulator of sulfonylurea-sensitive K(ATP) channel: molecular cloning, expression and biological properties." Heron L., Virsolvy A., Peyrollier K., Gribble F.M., Le Cam A., Ashcroft F.M., Bataille D. Proc. Natl. Acad. Sci. U.S.A. 95:8387-8391(1998) [PubMed: 9653196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, PHOSPHORYLATION. Tissue: Brain. [2] "Isolation, characterization, and chromosomal localization of the human ENSA gene that encodes alpha-endosulfine, a regulator of beta-cell K(ATP) channels." Heron L., Virsolvy A., Apiou F., Le Cam A., Bataille D. Diabetes 48:1873-1876(1999) [PubMed: 10480622] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). Tissue: Brain. [3] "The transcribed endosulfine alpha gene is located within a type 2 diabetes-linked region on 1q: sequence and expression analysis in Pima Indians." Thameem F., Farook V.S., Yang X., Lee Y.-H., Permana P.A., Bogardus C., Prochazka M. Mol. Genet. Metab. 81:16-21(2004) [PubMed: 14728987] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 5; 7 AND 8), TISSUE SPECIFICITY.
Alias: ARPP-19e.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 1 мг |
| Кат. номер: | CSB-RP017044h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Alpha-endosulfine protein. Примечание: дополнительная информация (на английском языке). |