Recombinant human ADP-ribosylation factor 5 protein
Relevance: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Product Info: GST tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: GLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Referrences: [1] "Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells." Tsuchiya M., Price S.R., Tsai S.-C., Moss J., Vaughan M. J. Biol. Chem. 266:2772-2777(1991) [PubMed: 1993656] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Localization and characterization of the human ADP-ribosylation factor 5 (ARF5) gene." McGuire R.E., Daiger S.P., Green E.D. Genomics 41:481-484(1997) [PubMed: 9169151] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. [3] "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Puhl H.L. III, Ikeda S.R., Aronstam R.S. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Brain.
Alias: .
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 10 мкг |
| Кат. номер: | CSB-RP009054h |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human ADP-ribosylation factor 5 protein. Примечание: дополнительная информация (на английском языке). |