Recombinant Bovine Tumor necrosis factor protein
Relevance: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
Product Info: His tagged
Source: E.coli derived
Purity: 95%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL
Referrences: [1] "Cloning of two members of the TNF-superfamily in cattle: CD40 ligand and tumor necrosis factor alpha." Mertens B.E.L.C., Muriuki M., Gaidulis L. Immunogenetics 42:430-431(1995) [PubMed: 7590981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 50-233 (ISOFORM 1). Tissue: Blood. [2] "Rapid communication: single strand conformational polymorphism (SSCP) of bovine tumor necrosis factor alpha." Dietz A.B., Neibergs H.L., Womack J.E., Kehrli M.E. Jr. J. Anim. Sci. 75:2567-2567(1997) [PubMed: 9303477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 91-193. Strain: Holstein.
Alias: Cachectin,TNF-alpha,Tumor necrosis factor ligand superfamily member 2,TNF-a.
Информация для заказа
| Область использования: | Производство: | Cusabio |
| Метод: | |
| Объем: | 50 мкг |
| Кат. номер: | CSB-RP084794B |
| Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant Bovine Tumor necrosis factor protein. Примечание: дополнительная информация (на английском языке). |