| Объем | 10 мкг |
| Категория | Drug Target |
| Подраздел | Immune Checkpoint |
| Области исследований | Cancer |
| Uniprot NO# | Q61735-2 |
| Наименование гена | Cd47 |
| Специфичность | Mus musculus (Mouse) |
| Источник | Mammalian cell |
| Регион экспрессии | 19-158aa |
| Последовательность | QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP |
| Описание белка | Partial of Isoform 2 |
| Информация о TAG | C-terminal 6xHis-tagged |
| Мол. вес | 16.7 kDa |
| Примечание | специальная цена до 30.06.2019! |
| Биологическая активность | The ED50 as determined by its ability to bind Mouse SIRPA in functional ELISA is less than 20 ug/ml. |
| Очистка | Greater than 95% as determined by SDS-PAGE. |
| Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. |
| Буфер хранения | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Альтернативное имя / Синоним | Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6 |
| Актуальность | CD47, also known as Integrin‑Associated Protein (IAP) and OA3, is a glycosylated atypical member of the immunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellular domain (ECD) with a single Ig‑like domain, five membrane-spanning regions with short intervening loops, and C‑terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. It plays an important role in memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cellcell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. It may play a role in membrane transport and/or integrin dependent signal transduction. It also prevents premature elimination of red blood cells. |
| Ссылка на страницу на сайте производителя | ссылка |
| | |