| Объем | 10 мкг |
| Категория | Drug Target |
| Подраздел | Immune Checkpoint |
| Области исследований | Immunology |
| Uniprot NO# | P42081 |
| Наименование гена | CD86 |
| Специфичность | Homo sapiens (Human) |
| Источник | Mammalian cell |
| Регион экспрессии | 24-247aa |
| Последовательность | APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP |
| Описание белка | Extracellular Domain |
| Информация о TAG | C-terminal 6xHis-tagged |
| Мол. вес | 26.69 kDa |
| Примечание | специальная цена до 30.06.2019! |
| Биологическая активность | The ED50 as determined by its ability to bind Human CTLA-4 in functional ELISA is less than 20 ug/ml. |
| Очистка | Greater than 95% as determined by SDS-PAGE. |
| Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. |
| Буфер хранения | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Альтернативное имя / Синоним | T-Lymphocyte Activation Antigen CD86; Activation B7-2 Antigen; B70; BU63; CTLA-4 Counter-Receptor B7.2; FUN-1; CD86; CD28LG2 |
| Актуальность | The protein is the receptor that involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. The protein interacts with MARCH8, human herpesvirus 8 MIR2 protein, adenovirus subgroup B fiber proteins and acts as a receptor for these viruses.It is expressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosis and lysosomal degradation.It contains 1 Ig-like C2-type(immunoglobulin-like) domainand 1 Ig-like V-type (immunoglobulin-like) domain. |
| Функция | Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.; FUNCTION |
| Субклеточное расположение | Cell membrane, Single-pass type I membrane protein |
| Тканевая специфичность | Expressed by activated B-lymphocytes and monocytes. |
| Сигнальный путь | Toll-likereceptorsignalingpathway |
| HGNC Database Link | ссылка |
| UniGene Database Link | ссылка |
| KEGG Database Link | ссылка |
| STRING Database Link | ссылка |
| OMIM Database Link | ссылка |
| Ссылка на страницу на сайте производителя | ссылка |
| | |