| Uniprot No# | P25194 |
| Специфичность | BCoV |
| Источник | E.coli |
| Информация о тегах | N-terminal 6xHis-tagged |
| Регион экспрессии | 326-540aa |
| Описание последовательности | Partial |
| Последовательность белка-мишени | PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT |
| Молекулярный вес | 27.7 kDa |
| Чистота | Greater than 90% as determined by SDS-PAGE. |
| Форма | Liquid or Lyophilized powder |
| Буфер | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Восстановление | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Ссылка на страницу на сайте производителя | ссылка |
| | |