Антитела Anti-CD16 antibody, кроличьи, поликлональные

Anti-CD16 antibody

Product nameAnti-CD16 antibody
See all CD16 primary antibodies
Description
Rabbit polyclonal to CD16
Tested applicationsFlow Cyt, IHC-P, WBmore details
Species reactivity
Reacts with: Mouse, Rat, Human
Immunogen
Synthetic peptide within Human CD16 aa 145-195 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:

GKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGL A

Database link: P08637

Run BLAST with Run BLAST with
Positive control
- U937 cells; Human lung cancer, human glioma and mouse spleen tissues.

FormLiquid
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Storage bufferPreservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA

Aqueous buffered solution
Concentration100 µl at 1 mg/ml
PurityProtein A purified
ClonalityPolyclonal
IsotypeIgG
Research areas

Our Abpromise guarantee covers the use of ab203883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application	Abreviews	Notes
Flow Cyt		1/20 - 1/100.
IHC-P		1/100 - 1/500. When using a fluorescent probe the recommended dilution is 1/50 – 1/200.
WB		1/100 - 1/1000. Predicted molecular weight: 29 kDa.

FunctionReceptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Tissue specificityExpressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
Sequence similaritiesContains 2 Ig-like C2-type (immunoglobulin-like) domains.
Post-translational
modificationsGlycosylated. Contains high mannose- and complex-type oligosaccharides.
The soluble form is produced by a proteolytic cleavage.
Cellular localizationCell membrane. Secreted. Exists also as a soluble receptor.
Information by UniProt
Database links
- Entrez Gene: 2214 Human
- Entrez Gene: 14131 Mouse
- Entrez Gene: 304966 Rat
- Omim: 146740 Human
- SwissProt: P08637 Human
- SwissProt: P08508 Mouse
- SwissProt: P27645 Rat
- Unigene: 372679 Human
see all
Alternative names
- CD 16 antibody
- CD 16a antibody
- CD16 antibody
see all

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD16 antibody (ab203883)

Immunohistochemical analysis of formalin-fixed, paraffin-embedded human glioma tissue labeling CD16 with ab203883 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.
Flow Cytometry - Anti-CD16 antibody (ab203883)

U937 cells probed with ab203883 at a 1/100 for 40 minutes followed by incubation with Goat Anti-Rabbit IgG PE conjugated secondary at 1/100 (green) for 40 minutes compared to control cells (blue).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD16 antibody (ab203883)

Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung cancer tissue labeling CD16 with ab203883 at 1/200 dilution followed by Goat Anti-Rabbit IgG, Cy3 conjugated secondary antibody at 1/200 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD16 antibody (ab203883)

Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse spleen tissue labeling CD16 with ab203883 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

Область использования: Прочие реагенты для иммуногистохимии	Производство:	Abcam
	Метод:
	Объем:	100 мкг
	Кат. номер:	ab203883
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Антитела Anti-CD16 antibody, кроличьи, поликлональные / Anti-CD16 antibody. Примечание: Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Дополнительная информация (на английском).