Recombinant mouse Adiponectin protein
Relevance: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Product Info:
Source:
Purity: 95%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20110930100920_MjNLRA==.jpg)
Tested applications: ELISA, Western blot,PETIA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0; 200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MLLLQALLFLLILPSHAEDDLVPPPKGTCAGWMAGIPGHP GHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTG AEGPRGFPGTPGRKGEPGEAAYMYRSAFSVGLETRVTVPN VPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVY MKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEV GDQVWLQVYGDGDHNGLYAD NVNDSTFTGFLLYHDTN
Referrences: [1] "Hydroxylation and glycosylation of the four conserved lysine residues in the collagenous domain of adiponectin. Potential role in the modulation of its insulin-sensitizing activity." Wang Y., Xu A., Knight C., Xu L.Y., Cooper G.J.S. J. Biol. Chem. 277:19521-19529(2002) [2] "The fat-derived hormone adiponectin reverses insulin resistance associated with both lipoatrophy and obesity." Yamauchi T., Kamon J., Waki H., Terauchi Y., Kubota N., Hara K., Mori Y., Ide T., Murakami K., Tsuboyama-Kasaoka N., Ezaki O., Akanuma Y., Gavrilova O., Vinson C., Reitman M.L., Kagechika H., Shudo K., Yoda M. , Nakano Y., Tobe K., Nagai R., Kimura S., Tomita M., Froguel P., Kadowaki T. Nat. Med. 7:941-946(2001)
Alias: 30 kDa adipocyte complement-related protein,Adipocyte complement-related 30 kDa protein,ACRP30,Adipocyte, C1q and collagen domain-containing protein,Adipocyte-specific protein AdipoQ.
Информация для заказа