Recombinant hunman Brain-derived neurotrophic factor protein
Relevance: During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20120321100359_MTE=.jpg)
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: ELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC
Referrences: [1] "Molecular cloning of a human gene that is a member of the nerve growth factor family." Jones K.R., Reichardt L.F. Proc. Natl. Acad. Sci. U.S.A. 87:8060-8064(1990) [PubMed: 2236018] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1). [2] "Human and rat brain-derived neurotrophic factor and neurotrophin-3: gene structures, distributions, and chromosomal localizations." Maisonpierre P.C., le Beau M.M., Espinosa R. III, Ip N.Y., Belluscio L., de la Monte S.M., Squinto S., Furth M.E., Yancopoulos G.D. Genomics 10:558-568(1991) [PubMed: 1889806] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). [3] "Characterization of the 5'-flanking region of the human brain-derived neurotrophic factor gene." Shintani A., Ono Y., Kaisho Y., Igarashi K. Biochem. Biophys. Res. Commun. 182:325-332(1992) [PubMed: 1339267] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Alias: BDNF,Abrineurin.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 50 мкг |
Кат. номер: | CSB-RP057744h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant hunman Brain-derived neurotrophic factor protein. Примечание: дополнительная информация (на английском языке). |