Recombinant human Transcriptional adapter 3 protein
Relevance: Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53-dependent transcriptional activation. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVD
Referrences: [[1] "Histone-like TAFs within the PCAF histone acetylase complex." Ogryzko V.V., Kotani T., Zhang X., Schiltz R.L., Howard T., Yang X.-J., Howard B.H., Qin J., Nakatani Y. Cell 94:35-44(1998) [PubMed: 9674425] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, INTERACTION WITH PCAF; TAF5L; TAF6L; TAF9; TAF10 AND TAF12. [2] "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A. Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis.
Alias: ADA3 homolog,hADA3,STAF54,Transcriptional adapter 3-like,ADA3-like protein.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 50 мкг |
Кат. номер: | CSB-RP034944h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant human Transcriptional adapter 3 protein. Примечание: дополнительная информация (на английском языке). |