Recombinant human Myelin P2 protein protein
Relevance: Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. May play a role in lipid transport protein in Schwann cells. May bind cholesterol.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20110930110927_NDA=.jpg)
Tested applications: ELISA, Western blot
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Referrences: [1]"Structural and functional characterization of human peripheral nervous system myelin protein P2." Majava V., Polverini E., Mazzini A., Nanekar R., Knoll W., Peters J., Natali F., Baumgartel P., Kursula I., Kursula P. PLoS ONE 5:E10300-E10300(2010) [2]"The complete amino acid sequence of human P2 protein." Suzuki M., Kitamura K., Sakamoto Y., Uyemura K. J. Neurochem. 39:1759-1762(1982)
Alias: Peripheral myelin protein 2.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 500 мкг |
Кат. номер: | CSB-RP078544h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant human Myelin P2 protein protein. Примечание: дополнительная информация (на английском языке). |