Recombinant human Midkine protein
Relevance: Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development By similarity.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20120322140309_MTA=.jpg)
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Referrences: [1] "A new family of heparin-binding factors: strong conservation of midkine (MK) sequences between the human and the mouse." Tsutsui J., Uehara K., Kadomatsu K., Matsubara S., Muramatsu T. Biochem. Biophys. Res. Commun. 176:792-797(1991) [PubMed: 2025291] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Kidney. [2] "Cloning, characterization and developmental regulation of two members of a novel human gene family of neurite outgrowth-promoting proteins." Kretschmer P.J., Fairhurst J.L., Decker M.M., Chan C.P., Gluzman Y., Boehlen P., Kovesdi I. Growth Factors 5:99-114(1991) [PubMed: 1768439] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, INDUCTION. Tissue: Fetal brain. [3] "Genomic structure of human midkine (MK), a retinoic acid-responsive growth/differentiation factor." Uehara K., Matsubara S., Kadomatsu K., Tsutsui J., Muramatsu T. J. Biochem. 111:563-567(1992) [PubMed: 1639750] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: Amphiregulin-associated protein,ARAP,Midgestation and kidney protein,Neurite outgrowth-promoting factor 2,Neurite outgrowth-promoting protein.
Информация для заказа