Recombinant human GTPase HRas protein
Relevance: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20120628150631_MjYtMjg=.jpg)
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
Referrences: [1] "Nucleotide sequence of the two rat cellular rasH genes." Ruta M., Wolford R., Dhar R., Defeo-Jones D., Ellis R.W., Scolnick E.M. Mol. Cell. Biol. 6:1706-1710(1986) [PubMed: 3023901] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Brain and Thymus. [3] "Nucleotide sequence and characterization of the 5' flanking region of the rat Ha-ras protooncogene." Damante G., Filetti S., Rapoport B. Proc. Natl. Acad. Sci. U.S.A. 84:774-778(1987) [PubMed: 3027702] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-37. [4] "Posttranslational modification of the Ha-ras oncogene protein: evidence for a third class of protein carboxyl methyltransferases." Clarke S., Vogel J.P., Deschenes R.J., Stock J. Proc. Natl. Acad. Sci. U.S.A. 85:4643-4647(1988) [PubMed: 3290900] [Abstract] Cited for: ISOPRENYLATION AT CYS-186, CLEAVAGE, METHYLATION AT CYS-186.
Alias: H-Ras-1;Transforming protein p21;c-H-ras;p21ras.
Информация для заказа