Recombinant human Ganglioside GM2 activator protein
Relevance: Binds gangliosides and stimulates ganglioside GM2 degradation. It stimulates only the breakdown of ganglioside GM2 and glycolipid GA2 by beta-hexosaminidase A. It extracts single GM2 molecules from membranes and presents them in soluble form to beta-hexosaminidase A for cleavage of N-acetyl-D-galactosamine and conversion to GM3
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride,20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Referrences: [1] "Isolation and expression of a full-length cDNA encoding the human G-M2 activator protein." Xie B., McInnes B., Neote K., Lamhonwah A.-M., Mahuran D. Biochem. Biophys. Res. Commun. 177:1217-1223(1991) [PubMed: 2059210] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANTS VAL-59 AND VAL-69. [2] "Characterization of full-length cDNAs and the gene coding for the human GM2 activator protein." Klima H., Tanaka A., Schnabel D., Nakano T., Schroeder M., Suzuki K., Sandhoff K. FEBS Lett. 289:260-264(1991) [PubMed: 1915857] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANTS THR-19; VAL-59 AND VAL-69. [3] "Evidence for two cDNAs encoding human GM2-activator protein." Nagarajan S., Chen H.C., Li S.C., Li Y.T., Lockyer J. Biochem. J. 282:807-813(1992) [PubMed: 1554364] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Placenta.
Alias: Cerebroside sulfate activator protein,GM2-AP,Shingolipid activator protein 3,SAP-3,Ganglioside GM2 activator isoform short.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP023754h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant human Ganglioside GM2 activator protein. Примечание: дополнительная информация (на английском языке). |