Recombinant human Chorionic somatomammotropin hormone protein
Relevance: Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization. Ref.14
Product Info: His tagged
Source: E.coli derived
Purity: 95%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20120620150610_UEVULUE0LTExMzctNA==.jpg)
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Referrences: [1] "Analysis of a major human chorionic somatomammotropin gene. Evidence for two functional promoter elements." Selby M.J., Barta A., Baxter J.D., Bell G.I., Eberhardt N.L. J. Biol. Chem. 259:13131-13138(1984) [PubMed: 6208192] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (CSH1). [2] "The human growth hormone gene locus: structure, evolution, and allelic variations." Hirt H., Kimelman J., Birnbaum M.J., Chen E.Y., Seeburg P.H., Eberhardt N.L., Barta A. DNA 6:59-70(1987) [PubMed: 3030680] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (CSH2). [3] "Two structurally different genes produce the same secreted human placental lactogen hormone." Barrera-Saldana H.A., Seeburg P.H., Saunders G.F. J. Biol. Chem. 258:3787-3793(1983) [PubMed: 6300056] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA].
Alias: Lactogen.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 500 мкг |
Кат. номер: | CSB-RP113774h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant human Chorionic somatomammotropin hormone protein. Примечание: дополнительная информация (на английском языке). |